Structure of PDB 8upp Chain I

Receptor sequence

>8uppI (length=327) Species: 197 (Campylobacter jejuni)

ITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGS
VSAVKAKNAGFEVMSVSEASKIADVIMILAPDEIQADIFNVEIKPNLSEG
KAIAFAHGFNIHYGQIVVPKGVDVIMIAPKAPGHTVRNEFTLGGGTPCLI
AIHQDESKNAKNLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCG
GLSALIQAGFETLVEAGYEPEMAYFECLHEMKLIVDLIYQGGIADMRYSI
SNTAEYGDYITGPKIITEETKKAMKGVLKDIQNGVFAKDFILERRAGFAR
MHAERKNMNDSLIEKTGRNLRAMMPWI

3D structure

• PDB: 8upp Mapping of the Reaction Trajectory catalyzed by Class I Ketol-Acid Reductoisomerase
• Chain: I
• Resolution: 1.78 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.86: ketol-acid reductoisomerase (NADP(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	I	D192 E196	D190 E194
BS02	X9W	I	A133 P134 D192 E196	A131 P132 D190 E194
BS03	NDP	I	F26 G27 S28 Q29 L48 S54 V68 L81 P83 D84 I86 I90 A108 H109	F24 G25 S26 Q27 L46 S52 V66 L79 P81 D82 I84 I88 A106 H107
BS04	X9W	I	E232 I252 S253 A256	E230 I250 S251 A254
BS05	NDP	I	S251 I252 S253	S249 I250 S251

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004455 ketol-acid reductoisomerase activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050661 NADP binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009099 L-valine biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:8upp, PDBe:8upp, PDBj:8upp
• PDBsum: 8upp
• UniProt: Q9PHN5|ILVC_CAMJE Ketol-acid reductoisomerase (NADP(+)) (Gene Name=ilvC)