Structure of PDB 8uha Chain I

Receptor sequence

>8uhaI (length=114) Species: 9823 (Sus scrofa) [Search protein sequence]

VGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHE
VDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLY
YVCTAPHCGHRWTE

3D structure

PDB

8uha Distinct negative elongation factor conformations regulate RNA polymerase II promoter-proximal pausing.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C17 E19 C20 N21	C6 E8 C9 N10
BS02	ZN	I	C86 C114 C119	C75 C103 C108

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus

External links

PDB	RCSB:8uha, PDBe:8uha, PDBj:8uha
PDBsum	8uha
PubMed	38401543
UniProt	P60899\|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)