Structure of PDB 8u5h Chain I

Receptor sequence
>8u5hI (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQRS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8u5h Cryo-EM structure of human DNMT3A N-terminal domain bound to H2AK119Ub nucleosome
ChainI
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna I H39 R40 Y41 P43 G44 V46 R49 K64 L65 R69 H2 R3 Y4 P6 G7 V9 R12 K27 L28 R32
BS02 dna I R40 R42 T45 R72 R83 F84 Q85 R86 R116 V117 T118 R3 R5 T8 R35 R46 F47 Q48 R49 R79 V80 T81
Gene Ontology
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8u5h, PDBe:8u5h, PDBj:8u5h
PDBsum8u5h
PubMed
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]