Structure of PDB 8tvq Chain I |
>8tvqI (length=117) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
FCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGET AGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLS CSHIFTSDQKNKRTQFS |
|
PDB | 8tvq Elf1 promotes Rad26's interaction with lesion-arrested Pol II for transcription-coupled repair. |
Chain | I |
Resolution | 4.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
S105 C106 |
S100 C101 |
|
|
|
|