Structure of PDB 8t56 Chain I

Receptor sequence
>8t56I (length=36) Species: 32630 (synthetic construct) [Search protein sequence]
FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLW
3D structure
PDB8t56 Structure of mechanically activated ion channel OSCA2.3 reveals mobile elements in the transmembrane domain.
ChainI
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide I K6 V9 K10 W17 E22 K25 K29 K6 V9 K10 W17 E22 K25 K29
BS02 LBN I F13 A14 A20 K23 F13 A14 A20 K23
BS03 CLR I F5 A8 Y12 F16 F5 A8 Y12 F16
External links