Structure of PDB 8smr Chain I

Receptor sequence

>8smrI (length=403) Species: 287 (Pseudomonas aeruginosa)

MNKFMAWVDARFPATKMWEDHLSKYYAPKNFNFWYFFGSLALLVLVNQIL
TGIWLTMSFTPSAEEAFASVEYIMRDVDYGWIIRYMHSTGASAFFIVVYL
HMFRGLLYGSYQKPRELVWIFGMLIYLALMAEAFMGYLLPWGQMSYWGAQ
VIISLFGAIPVVGEDLAQWIRGDFLISGITLNRFFALHVIALPIVLLGLV
VLHILALHEVGSNNPDGVDIKKKKDENGVPLDGIAFHPYYTVKDIVGVVV
FLFIFCTVIFFFPEMGGYFLEKPNFEMANQFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVVAMGAAIAVLFVLPWLDRSPVRSIRYKGWLSKLWLVIFAV
SFVILGYYGAQAPSPLGTTLSRVCTVLYFAFFILMPFYTRMEKTKPVPER
VTG

3D structure

• PDB: 8smr Structure of the bc 1 - cbb 3 respiratory supercomplex from Pseudomonas aeruginosa.
• Chain: I
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	I	Y35 G38 A41 L42 F94 V98 H101 M102 R104 S110 V118 W119 G122 M123 I125 H203 L207 S212 N213	Y35 G38 A41 L42 F94 V98 H101 M102 R104 S110 V118 W119 G122 M123 I125 H203 L207 S212 N213
BS02	HEM	I	Q48 G52 I53 L55 T56 F59 R84 H87 A91 F94 E132 G136 L139 P140 H188 V189 P193	Q48 G52 I53 L55 T56 F59 R84 H87 A91 F94 E132 G136 L139 P140 H188 V189 P193
BS03	U10	I	F134 V151 I152 F156 W169 I287 P289 Y297 L300 M313	F134 V151 I152 F156 W169 I287 P289 Y297 L300 M313
BS04	I7Y	I	A302 P304 M308 V311 A312 A315 R372 F379	A302 P304 M308 V311 A312 A315 R372 F379

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:8smr, PDBe:8smr, PDBj:8smr
• PDBsum: 8smr
• PubMed: 37751552
• UniProt: Q9HVY5