Structure of PDB 8s8h Chain I

Receptor sequence

>8s8hI (length=188) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

GISRDSRHKRAATGAKRAQFRKKRKFELGRQAANTKIGTKRIHPVRTRGG
NQKFRALRIETGNFSWASEGVARKTRITGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWYESHYGQSLGKTSKNTERKWAARAAEAKIEHAVDSQFGA
GRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK

3D structure

PDB

8s8h Structural basis of AUC codon discrimination during translation initiation in yeast.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G2 R5 H9 K10 R11 T14 A16 R18 R22 K23 K24 R25 K26 F27 G30 R31 Q32 I43 R47 T48 R49 G50 N52 K54 R56 L58 R59 N64 A73 S86 T97 K98 N139 R142 S171 S172 R173 G175 Q176 S177 R179 D181	G1 R4 H8 K9 R10 T13 A15 R17 R21 K22 K23 R24 K25 F26 G29 R30 Q31 I42 R46 T47 R48 G49 N51 K53 R55 L57 R58 N63 A72 S85 T96 K97 N126 R129 S158 S159 R160 G162 Q163 S164 R166 D168

External links

PDB	RCSB:8s8h, PDBe:8s8h, PDBj:8s8h
PDBsum	8s8h
PubMed	39193907
UniProt	Q6CMG3

[Back to BioLiP]