Structure of PDB 8r6c Chain I

Receptor sequence

>8r6cI (length=127) Species: 679895 (Escherichia coli BW25113)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 8r6c Paenilamicins from the honey bee pathogen Paenibacillus larvae are context-specific translocation inhibitors of protein synthesis.
• Chain: I
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Q5 Y7 T9 R11 R12 K13 S14 R18 F20 R33 Y38 Y64 G69 G70 G71 I72 S73 Q75 R85 R99 T105 R106 A108 R109 Q110 V111 E112 R113 K114 K115 V116 G117 R119 K120 R122 R123 R124 Q126 F127 K129 R130	Q2 Y4 T6 R8 R9 K10 S11 R15 F17 R30 Y35 Y61 G66 G67 G68 I69 S70 Q72 R82 R96 T102 R103 A105 R106 Q107 V108 E109 R110 K111 K112 V113 G114 R116 K117 R119 R120 R121 Q123 F124 K126 R127
BS02	rna	I	K129 R130	K126 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8r6c, PDBe:8r6c, PDBj:8r6c
• PDBsum: 8r6c
• PubMed: 38826346
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)