Structure of PDB 8r55 Chain I

Receptor sequence

>8r55I (length=125) Species: 1423 (Bacillus subtilis)

QYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTL
TETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
TRDARMKERKKYGLKGARRAPQFSK

3D structure

• PDB: 8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.
• Chain: I
• Resolution: 3.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Y7 R11 K13 S14 V16 R18 R20 P40 N66 G69 G70 G71 L72 S73 G74 R85 R95 K99 T105 R106 R109 M110 K111 E112 R113 K114 K115 Y116 A121 R122 R123 A124 P125 Q126 F127	Y3 R7 K9 S10 V12 R14 R16 P36 N62 G65 G66 G67 L68 S69 G70 R81 R91 K95 T101 R102 R105 M106 K107 E108 R109 K110 K111 Y112 A117 R118 R119 A120 P121 Q122 F123

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8r55, PDBe:8r55, PDBj:8r55
• PDBsum: 8r55
• PubMed: 38177497
• UniProt: A0A063XCS1