Structure of PDB 8qpp Chain I

Receptor sequence

>8qppI (length=125) Species: 1423 (Bacillus subtilis)

QYYGTGRRKSSVARVRLVPGEGRIVVNNREISEHIPSAALIEDIKQPLTL
TETAGTYDVLVNVHGGGLSGQAGAIRHGIARALLEADPEYRTTLKRAGLL
TRDARMKERKKYGLKGARRAPQFSK

3D structure

• PDB: 8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
• Chain: I
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Y7 T9 R11 R12 K13 S14 R18 R20 P40 N66 G69 G70 G71 L72 S73 Q75 R85 K99 T105 R106 A108 R109 M110 K111 E112 R113 K114 K115 Y116 K119 A121 R122 R123 A124 Q126 F127 S128	Y3 T5 R7 R8 K9 S10 R14 R16 P36 N62 G65 G66 G67 L68 S69 Q71 R81 K95 T101 R102 A104 R105 M106 K107 E108 R109 K110 K111 Y112 K115 A117 R118 R119 A120 Q122 F123 S124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
• PDBsum: 8qpp
• PubMed: 38177497
• UniProt: A0A063XCS1