Structure of PDB 8qbl Chain I

Receptor sequence

>8qblI (length=309) Species: 469008 (Escherichia coli BL21(DE3))

SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYT
VEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSI
LNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKI
CCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLS
AQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEK
VGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITY
ISKLEKKYG

3D structure

• PDB: 8qbl Retron-Eco1 assembles NAD + -hydrolyzing filaments that provide immunity against bacteriophages.
• Chain: I
• Resolution: 2.66 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.49: RNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	K56 G57 P58 F96 E97 K98 H99 Q100 S101 G162 A163 P164 K230 C233 R238 S239 Q240 R257 K261 A265 G283 S286 S290	K54 G55 P56 F94 E95 K96 H97 Q98 S99 G160 A161 P162 K228 C231 R236 S237 Q238 R255 K259 A263 G281 S284 S288
BS02	rna	I	F217 S218	F215 S216
BS03	dna	I	E35 L39 F46 Q67 P68 A129 K131 S147 K151 K156 G183 T244 G283	E33 L37 F44 Q65 P66 A127 K129 S145 K149 K154 G181 T242 G281

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003964 RNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006974 DNA damage response
• GO:0051607 defense response to virus

External links

• PDB: RCSB:8qbl, PDBe:8qbl, PDBj:8qbl
• PDBsum: 8qbl
• PubMed: 38788717
• UniProt: P23070|RT86_ECOLX Retron Ec86 reverse transcriptase (Gene Name=ret)