Structure of PDB 8q0q Chain I

Receptor sequence
>8q0qI (length=176) Species: 9913 (Bos taurus) [Search protein sequence]
TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINY
PFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRA
DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN
KEKLLNNGDKWEAEIAANIQADYLYR
3D structure
PDB8q0q Molecular mechanism of the ischemia-induced regulatory switch in mammalian complex I
ChainI
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I H65 C87 I92 C116 I117 Y118 C119 G120 F121 C122 E133 H65 C87 I92 C116 I117 Y118 C119 G120 F121 C122 E133
BS02 SF4 I C77 I78 A79 C80 K81 C83 I94 Y109 C126 I131 C77 I78 A79 C80 K81 C83 I94 Y109 C126 I131
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q0q, PDBe:8q0q, PDBj:8q0q
PDBsum8q0q
PubMed38870289
UniProtP42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (Gene Name=NDUFS8)

[Back to BioLiP]