Structure of PDB 8p2i Chain I |
>8p2iI (length=58) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] |
EKACRHCHYITSEDRCPVCGSRDLSEEWFDLVIIVDVENSEIAKKIGAKV PGKYAIRV |
|
PDB | 8p2i Structural basis of archaeal RNA polymerase transcription elongation and Spt4/5 recruitment |
Chain | I |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
I |
C6 C9 C18 C21 |
C4 C7 C16 C19 |
|
|
|
|