Structure of PDB 8ozh Chain I |
>8ozhI (length=58) Species: 2170195 (Eastern chimpanzee simian foamy virus) [Search protein sequence] |
YTCCATSSRVLAWIFLVCILLIIVLVSCFVTISRIQWNKDIQVLGPVIDW NVTQRAVY |
|
PDB | 8ozh Integrated cryoEM structure of a spumaretrovirus reveals cross-kingdom evolutionary relationships and the molecular basis for assembly and virus entry |
Chain | I |
Resolution | 2.91 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
I |
A114 Y116 |
A56 Y58 |
|
|
|