Structure of PDB 8kda Chain I

Receptor sequence

>8kdaI (length=189) Species: 608538 (Hydrogenobacter thermophilus TK-6)

MDTFVLDTSVFTNPDVYHQFEEDQLGAIENFISLASHTNANFFMPTSVYY
EFTKMVSLGDLAPKFELVVRIRSPRKWGLMVPAEFLYEFIEEVRYRINKG
LRIAEEHTKEAGKLAEEEVGRVVNRLREKYREALRAGIIDSKEDVDVLLL
SYELDAILVSGDEGLRKWADRVGIKLIDPKNLRYIMENL

3D structure

• PDB: 8kda Cryo-EM structure of Hydrogenobacter thermophilus minimal protein-only RNase P (HARP) in complex with pre-tRNAs
• Chain: I
• Resolution: 3.19 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	N13 G161 D162	N13 G161 D162

External links

• PDB: RCSB:8kda, PDBe:8kda, PDBj:8kda
• PDBsum: 8kda
• UniProt: D3DIV8