Structure of PDB 8je1 Chain I

Receptor sequence

>8je1I (length=223) Species: 9606 (Homo sapiens)

THKDLLRFAQVFSQMIHLNDIECVLRCSVLEIEQSMNRVKNISDADVHNA
MDNYECNLYTFLYLVCISTSEEDQCKINKQIYNLIHLDPRTREGFTLLHL
AVNSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHS
IIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARA
VRANDINYQDQIPRTLEEFVGFH

3D structure

• PDB: 8je1 Structural insights into the ubiquitylation strategy of the oligomeric CRL2 FEM1B E3 ubiquitin ligase.
• Chain: I
• Resolution: 3.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	D567 H627	D163 H223

Gene Ontology

Molecular Function

• GO:0005123 death receptor binding
• GO:0005515 protein binding
• GO:0046872 metal ion binding
• GO:1990756 ubiquitin-like ligase-substrate adaptor activity

Biological Process

• GO:0002070 epithelial cell maturation
• GO:0006915 apoptotic process
• GO:0016567 protein ubiquitination
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051438 regulation of ubiquitin-protein transferase activity
• GO:0060442 branching involved in prostate gland morphogenesis
• GO:0060743 epithelial cell maturation involved in prostate gland development
• GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
• GO:1902041 regulation of extrinsic apoptotic signaling pathway via death domain receptors
• GO:2000001 regulation of DNA damage checkpoint

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0031462 Cul2-RING ubiquitin ligase complex

External links

• PDB: RCSB:8je1, PDBe:8je1, PDBj:8je1
• PDBsum: 8je1
• PubMed: 38360992
• UniProt: Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B (Gene Name=FEM1B)