Structure of PDB 8iue Chain I

Receptor sequence

>8iueI (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVD
DVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNA
QCGHRWR

3D structure

PDB

8iue Structure of the SNAPc-bound RNA polymerase III preinitiation complex.

Chain

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C5 C25	C5 C25

Gene Ontology

	Molecular Function
GO:0001056	RNA polymerase III activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006383	transcription by RNA polymerase III
GO:0006386	termination of RNA polymerase III transcription
GO:0045087	innate immune response
GO:0051607	defense response to virus

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005666	RNA polymerase III complex
GO:0005829	cytosol

External links

PDB	RCSB:8iue, PDBe:8iue, PDBj:8iue
PDBsum	8iue
PubMed	37165065
UniProt	Q9Y2Y1\|RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 (Gene Name=POLR3K)