Structure of PDB 8hyj Chain I

Receptor sequence

>8hyjI (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

STMKFCRECNNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHP
TLPRTKAVRCSKCQHREAVFFQATARGEEGMTLFFVCCNPNCGHRWRE

3D structure

PDB

8hyj A cryo-EM structure of KTF1-bound polymerase V transcription elongation complex.

Chain

Resolution

4.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C7 C29 C32	C6 C28 C31

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription

	Cellular Component
GO:0000419	RNA polymerase V complex
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus

External links

PDB	RCSB:8hyj, PDBe:8hyj, PDBj:8hyj
PDBsum	8hyj
PubMed	37253723
UniProt	Q6NLH0\|RPB9A_ARATH DNA-directed RNA polymerases II, IV and V subunit 9A (Gene Name=NRPB9A)