Structure of PDB 8e9i Chain I

Receptor sequence
>8e9iI (length=166) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KFLDALAGFAVTLGSMFKKPITEGYPEKPGPVAPRYHGRHQLNRYPDGLE
KCIGCELCAWACPADAIYVEGADNTADERYSPGERYGRVYQINYLRCIGC
GLCIEACPTRALTMTTEYEMADDNRADLIWGKDKLLAPLQEGMQAPPHDM
APGKTDDDYYLGNVTP
3D structure
PDB8e9i Structure of mycobacterial respiratory complex I.
ChainI
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I H42 C64 I69 C99 I100 G101 C102 G103 C105 H40 C62 I67 C97 I98 G99 C100 G101 C103
BS02 SF4 I C54 I55 G56 C57 E58 L59 C60 Y92 C109 P110 C52 I53 G54 C55 E56 L57 C58 Y90 C107 P108
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e9i, PDBe:8e9i, PDBj:8e9i
PDBsum8e9i
PubMed36952383
UniProtA0QU28|NUOI_MYCS2 NADH-quinone oxidoreductase subunit I (Gene Name=nuoI)

[Back to BioLiP]