Structure of PDB 8d8l Chain I

Receptor sequence

>8d8lI (length=209) Species: 4932 (Saccharomyces cerevisiae)

RRIVPKLATFYSANPNHEDRINRLERLLRKYIKLPSQAPWISFDEYALIG
GGTKLKPTQYTQLLYMLNKLHNIDPQLTNDEITSELSQYYKKIKTLDEFG
RSIAVGKRKSSTAKVFVVRGTGEILVNGRQLNDYFLKMKDRESIMYPLQV
IESVGKYNIFATTSGGGPTGQAESIMHAIAKALVVFNPLLKSRLHKAGVL
TRDYRHVER

3D structure

• PDB: 8d8l Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: I
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	R63 I66 K67 K97 K99 P100 T101 Q105 Y108 K159 R160 K161 S162 K166 R181 Y186 L188 K189 K191 T214 S216 G217 G218 G219 T221 Q223 K243 S244 H247 K248 L252 T253 R254 Y256 R257 H258 V259 E260 R261	R29 I32 K33 K54 K56 P57 T58 Q62 Y65 K107 R108 K109 S110 K114 R129 Y134 L136 K137 K139 T162 S164 G165 G166 G167 T169 Q171 K191 S192 H195 K196 L200 T201 R202 Y204 R205 H206 V207 E208 R209

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8d8l, PDBe:8d8l, PDBj:8d8l
• PDBsum: 8d8l
• PubMed: 36482135
• UniProt: P38120|RT09_YEAST Small ribosomal subunit protein uS9m (Gene Name=MRPS9)