Structure of PDB 8csr Chain I

Receptor sequence

>8csrI (length=137) Species: 9606 (Homo sapiens)

TKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPL
AFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPG
RLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL

3D structure

• PDB: 8csr Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: I
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	H87 K89 N93 N94 Q96 Q98 N104 P106 S111 G113 T114 N119 A120 K122 K152 I181 P182 H183 N184 G185 C186 R187 P188 R189 K190 R192 K193 L194	H30 K32 N36 N37 Q39 Q41 N47 P49 S54 G56 T57 N62 A63 K65 K95 I124 P125 H126 N127 G128 C129 R130 P131 R132 K133 R135 K136 L137

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8csr, PDBe:8csr, PDBj:8csr
• PDBsum: 8csr
• PubMed: 36482135
• UniProt: P82912|RT11_HUMAN Small ribosomal subunit protein uS11m (Gene Name=MRPS11)