Structure of PDB 8ca5 Chain I

Receptor sequence

>8ca5I (length=178) Species: 10090 (Mus musculus)

TYKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATI
NYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEP
RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELL
YNKEKLLNNGDKWEAEIAANIQADYLYR

3D structure

• PDB: 8ca5 Cryo-EM structure NDUFS4 knockout complex I from Mus musculus heart (Class 3).
• Chain: I
• Resolution: 3.9 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	I	C79 I80 A81 C82 K83 C85 Y111 C128 P129 A132 I133	C79 I80 A81 C82 K83 C85 Y111 C128 P129 A132 I133
BS02	SF4	I	H67 C89 P90 I94 C118 I119 Y120 C121 G122 C124 E135	H67 C89 P90 I94 C118 I119 Y120 C121 G122 C124 E135

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0005515 protein binding
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0016491 oxidoreductase activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0009060 aerobic respiration
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:0042776 proton motive force-driven mitochondrial ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:8ca5, PDBe:8ca5, PDBj:8ca5
• PDBsum: 8ca5
• PubMed: 38177503
• UniProt: Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (Gene Name=Ndufs8)