Structure of PDB 8bws Chain I

Receptor sequence

>8bwsI (length=55) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKE
VDDVL

3D structure

PDB

8bws Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	4QM	I	P6 Y31 F33	P6 Y31 F33
BS02	ZN	I	C8 C26 C29	C8 C26 C29

Gene Ontology

	Molecular Function
GO:0001056	RNA polymerase III activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005666	RNA polymerase III complex
GO:0005730	nucleolus
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:8bws, PDBe:8bws, PDBj:8bws
PDBsum	8bws
PubMed	36977686
UniProt	Q04307\|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 (Gene Name=RPC11)