Structure of PDB 8a40 Chain I

Receptor sequence
>8a40I (length=114) Species: 9823 (Sus scrofa) [Search protein sequence]
VGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHE
VDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLY
YVCTAPHCGHRWTE
3D structure
PDB8a40 Structure of a backtracked hexasomal intermediate of nucleosome transcription.
ChainI
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN I S51 C52 S40 C41
BS02 ZN I C17 C39 C6 C28
BS03 ZN I C86 C114 C75 C103
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001193 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006351 DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a40, PDBe:8a40, PDBj:8a40
PDBsum8a40
PubMed35858621
UniProtP60899|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)

[Back to BioLiP]