Structure of PDB 8a3y Chain I

Receptor sequence

>8a3yI (length=116) Species: 9823 (Sus scrofa)

GFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKIT
HEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMR
LYYVCTAPHCGHRWTE

3D structure

• PDB: 8a3y Structure of a backtracked hexasomal intermediate of nucleosome transcription.
• Chain: I
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C17 C39 C42	C8 C30 C33
BS02	ZN	I	C86 C114 C119	C77 C105 C110

Gene Ontology

Molecular Function

• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001193 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
• GO:0006283 transcription-coupled nucleotide-excision repair
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005665 RNA polymerase II, core complex
• GO:0005730 nucleolus

External links

• PDB: RCSB:8a3y, PDBe:8a3y, PDBj:8a3y
• PDBsum: 8a3y
• PubMed: 35858621
• UniProt: P60899|RPB9_PIG DNA-directed RNA polymerase II subunit RPB9 (Gene Name=POLR2I)