Structure of PDB 7zc5 Chain I

Receptor sequence
>7zc5I (length=145) Species: 511693 (Escherichia coli BL21) [Search protein sequence]
EPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDG
RWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEYKRQDLVYEKE
DLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP
3D structure
PDB7zc5 A universal coupling mechanism of respiratory complex I.
ChainI
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I I48 C70 C74 I75 C99 I100 F101 C102 G103 C105 I13 C35 C39 I40 C64 I65 F66 C67 G68 C70
BS02 SF4 I C60 V61 A62 C63 N64 L65 C66 C109 P110 T111 A113 I114 C25 V26 A27 C28 N29 L30 C31 C74 P75 T76 A78 I79
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030964 NADH dehydrogenase complex
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zc5, PDBe:7zc5, PDBj:7zc5
PDBsum7zc5
PubMed36104567
UniProtP0AFD6|NUOI_ECOLI NADH-quinone oxidoreductase subunit I (Gene Name=nuoI)

[Back to BioLiP]