Structure of PDB 7z1o Chain I

Receptor sequence

>7z1oI (length=110) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKE
VDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKC
VNCGHRWKEN

3D structure

PDB

7z1o Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C5 C26	C5 C26
BS02	ZN	I	C69 C100	C69 C100

Gene Ontology

	Molecular Function
GO:0001056	RNA polymerase III activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005666	RNA polymerase III complex
GO:0005730	nucleolus
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:7z1o, PDBe:7z1o, PDBj:7z1o
PDBsum	7z1o
PubMed	36070694
UniProt	Q04307\|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 (Gene Name=RPC11)