Structure of PDB 7z1l Chain I

Receptor sequence
>7z1lI (length=110) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKE
VDDVLGGGWDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKC
VNCGHRWKEN
3D structure
PDB7z1l Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
ChainI
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN I C69 C100 C69 C100
BS02 ZN I C5 C26 C29 C5 C26 C29
Gene Ontology
Molecular Function
GO:0001056 RNA polymerase III activity
GO:0003676 nucleic acid binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z1l, PDBe:7z1l, PDBj:7z1l
PDBsum7z1l
PubMed36070694
UniProtQ04307|RPC10_YEAST DNA-directed RNA polymerase III subunit RPC10 (Gene Name=RPC11)

[Back to BioLiP]