Structure of PDB 7yca Chain I

Receptor sequence
>7ycaI (length=35) Species: 70448 (Ostreococcus tauri) [Search protein sequence]
MAASLLPSIFVPLVGLVFPAVAMASLFLYIEKEQV
3D structure
PDB7yca The photosystem I supercomplex from a primordial green alga Ostreococcus tauri harbors three light-harvesting complex trimers.
ChainI
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I F18 S25 F18 S25
BS02 CLA I L6 P7 F10 V11 V14 L6 P7 F10 V11 V14
BS03 CLA I V11 M23 V11 M23
BS04 CLA I P12 G15 L16 P12 G15 L16
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yca, PDBe:7yca, PDBj:7yca
PDBsum7yca
PubMed36951548
UniProtQ0P3K0|PSAI_OSTTA Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]