Structure of PDB 7y7b Chain I

Receptor sequence
>7y7bI (length=33) Species: 173977 (Chroomonas placoidea) [Search protein sequence]
MTAAYLPSILVPLIGLIFPGFVMGFAFIYIEQE
3D structure
PDB7y7b Structural basis and evolution of the photosystem I-light-harvesting supercomplex of cryptophyte algae.
ChainI
Resolution2.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I F21 F25 F21 F25
BS02 CLA I Y5 S8 I9 P12 L13 L16 I17 Y5 S8 I9 P12 L13 L16 I17
BS03 CLA I L6 P7 L10 I14 L6 P7 L10 I14
BS04 CLA I F27 E31 F27 E31
BS05 8CT I I14 P19 I14 P19
BS06 CLA I G15 L16 G15 L16
BS07 IHT I M23 A26 M23 A26
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y7b, PDBe:7y7b, PDBj:7y7b
PDBsum7y7b
PubMed36943796
UniProtA0A222AI78

[Back to BioLiP]