Structure of PDB 7xn7 Chain I

Receptor sequence

>7xn7I (length=111) Species: 460519 (Komagataella phaffii) [Search protein sequence]

SFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNI
GETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYV
CLNCKKTFRDE

3D structure

PDB

7xn7 Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C78 N105	C76 N103
BS02	ZN	I	C10 C32	C8 C30

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006367	transcription initiation at RNA polymerase II promoter

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links