Structure of PDB 7vxp Chain I |
>7vxpI (length=97) Species: 9823 (Sus scrofa) [Search protein sequence] |
ASATRVIQLLRNWASGRDLQAKLQLRYQEISKRTQPPPKLPVGPSHKLSN NYYCTRDGRREAMPPSIVMSSQKTEKKAVTPAPPIKRWELSKDQPYL |
|
PDB | 7vxp The coupling mechanism of mammalian mitochondrial complex I. |
Chain | I |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
I |
R18 K40 D109 |
R17 K39 D93 |
|
|
|
|