Structure of PDB 7uzy Chain I |
>7uzyI (length=110) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] |
MTFAHEVVKSNLFNGLTTSKLRNLMEQVNRLYTIAFNSNEDQLNEEFIDE LEYLKIKFYYEAGREKSVDEFLKKTLMFPIIDRVIKKESKKFFLDYCKYF EALVAYAKYY |
|
PDB | 7uzy Structures of an active type III-A CRISPR effector complex. |
Chain | I |
Resolution | 4.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
I |
R49 E53 R91 |
R22 E26 R64 |
|
|
|
|