Structure of PDB 7umh Chain I

Receptor sequence
>7umhI (length=37) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESE
3D structure
PDB7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.
ChainI
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA I P11 L14 V18 P11 L14 V18
BS02 CLA I F22 P23 F22 P23
BS03 CLA I G19 W20 G19 W20
BS04 CLA I W20 F31 W20 F31
BS05 CLA I A24 M27 A24 M27
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum7umh
PubMed37532717
UniProtQ55330|PSAI_SYNY3 Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]