Structure of PDB 7ug6 Chain I

Receptor sequence
>7ug6I (length=111) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MGRYSVKRYKTKRRTRDLDLIYNDLSTKESVQKLLNQPLDETKPGLGQHY
CIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNK
FLNRVQEITQS
3D structure
PDB7ug6 A single 2'-O-methylation of ribosomal RNA gates assembly of a functional ribosome.
ChainI
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I M1 G2 R3 Y4 S5 K7 R8 Y9 K10 K12 R13 K56 E59 H67 K71 R75 K78 M1 G2 R3 Y4 S5 K7 R8 Y9 K10 K12 R13 K56 E59 H67 K71 R75 K78
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
GO:0043023 ribosomal large subunit binding
GO:0046872 metal ion binding
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ug6, PDBe:7ug6, PDBj:7ug6
PDBsum7ug6
PubMed36536102
UniProtQ08004|BUD20_YEAST Bud site selection protein 20 (Gene Name=BUD20)

[Back to BioLiP]