Structure of PDB 7ttw Chain I

Receptor sequence
>7ttwI (length=78) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
SSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDD
TLFAKIDGVVKFERKGRDKKQVSVYAVA
3D structure
PDB7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainI
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I N20 R22 S24 E25 S26 K27 R28 L29 A34 D35 T40 G42 I44 Y46 R47 R49 G50 T51 G62 G63 D64 F68 F77 K85 N5 R7 S9 E10 S11 K12 R13 L14 A19 D20 T25 G27 I29 Y31 R32 R34 G35 T36 G47 G48 D49 F53 F62 K70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum7ttw
PubMed35736238
UniProtQ2FXT0|RL27_STAA8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]