Structure of PDB 7r7p Chain I |
>7r7pI (length=102) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
GGSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQN ANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNTAT IM |
|
PDB | 7r7p Structural basis of HIV-1 maturation inhibitor binding and activity. |
Chain | I |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2I4 |
I |
K227 L231 M235 |
K84 L88 M92 |
|
|
|