Structure of PDB 7qso Chain I

Receptor sequence

>7qsoI (length=176) Species: 9913 (Bos taurus)

TYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINY
PFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRA
DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN
KEKLLNNGDKWEAEIAANIQADYLYR

3D structure

• PDB: 7qso Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
• Chain: I
• Resolution: 3.02 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	I	H65 C87 P88 I92 C116 I117 Y118 C119 G120 F121 C122 E133	H65 C87 P88 I92 C116 I117 Y118 C119 G120 F121 C122 E133
BS02	SF4	I	C77 I78 A79 C80 K81 L82 C83 Y109 C126 P127 A130 I131	C77 I78 A79 C80 K81 L82 C83 Y109 C126 P127 A130 I131

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0016491 oxidoreductase activity
• GO:0016651 oxidoreductase activity, acting on NAD(P)H
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7qso, PDBe:7qso, PDBj:7qso
• PDBsum: 7qso
• PubMed: 35589726
• UniProt: P42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (Gene Name=NDUFS8)