Structure of PDB 7qiy Chain I

Receptor sequence

>7qiyI (length=82) Species: 4081 (Solanum lycopersicum)

GRVRTKTVKKSSRQVIERYYSKMTLDFHTNKKILEEVAIIPSKRLRNKIA
GFSTHLMKRIQKGPVRGISLKLQEEERERRMD

3D structure

• PDB: 7qiy Cryo-EM structure and rRNA modification sites of a plant ribosome.
• Chain: I
• Resolution: 2.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	G2 R3 V4 R5 T6 K7 K10 R14 F28 K32 S43 K44 R45 N48 K49 H56 R60 R67	G1 R2 V3 R4 T5 K6 K9 R13 F27 K31 S42 K43 R44 N47 K48 H55 R59 R66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qiy, PDBe:7qiy, PDBj:7qiy
• PDBsum: 7qiy
• PubMed: 35643637
• UniProt: P49215|RS17_SOLLC Small ribosomal subunit protein eS17 (Gene Name=RPS17)