Structure of PDB 7pnt Chain I

Receptor sequence
>7pntI (length=137) Species: 10090 (Mus musculus) [Search protein sequence]
SRFSLYPPVPGQESSLQWAGMKFEDVPIAHIKATYNNTQIQVVSATNASL
ARASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHIRVVVKGMGPG
RWSAIKGLTMGGLEVISITDNTPVPHAGCRPRKARRL
3D structure
PDB7pnt Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainI
Resolution3.19 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I H84 K86 N90 N91 Q93 Q95 N101 R106 S108 G110 T111 N116 A117 K119 P177 V178 H180 X181 G182 C183 R184 R186 K187 R189 R190 L191 H30 K32 N36 N37 Q39 Q41 N47 R52 S54 G56 T57 N62 A63 K65 P123 V124 H126 X127 G128 C129 R130 R132 K133 R135 R136 L137
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnt, PDBe:7pnt, PDBj:7pnt
PDBsum7pnt
PubMed35676484
UniProtQ9DCA2|RT11_MOUSE Small ribosomal subunit protein uS11m (Gene Name=Mrps11)

[Back to BioLiP]