Structure of PDB 7pkt Chain I

Receptor sequence

>7pktI (length=97) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

VFKTTGGRSWNPPSGLRPLSPAQRRNRTKNLALTMKNMSILKLAEANQPE
VPVRLYKPLNFSRMQWMKKKLEETRAALGWDMEARALQEQARALRVG

3D structure

PDB

7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	I	F11 L25 R26 L28 R36 L40 M44 M47	F2 L16 R17 L19 R27 L31 M35 M38
BS02	rna	I	R72 W75	R63 W66
BS03	rna	I	V10 F11 K12 G15 R17 W19 S29 A31 Q32 R34 N35 K38 N39 R63 L64 Y65 K66 N69 F70 S71 W75	V1 F2 K3 G6 R8 W10 S20 A22 Q23 R25 N26 K29 N30 R54 L55 Y56 K57 N60 F61 S62 W66
BS04	rna	I	R34 T37 K38 A41 K45 K77	R25 T28 K29 A32 K36 K68
BS05	rna	I	R17 S18	R8 S9

External links