Structure of PDB 7pib Chain I

Receptor sequence
>7pibI (length=101) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
VKYPELKIKLESYDSTLLDLTTKKIVEVVKGVDVKIKGPLPLPTKKEVIT
IIRSPHVDKASREQFEKNRHKRLMILVDVNQGAIDSLKRIKIPVGVTLRF
S
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainI
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I K15 S21 D25 K43 G44 L46 P47 P49 T50 K51 K52 E53 T56 R59 S60 P61 H62 V63 K65 R68 Q70 H76 R78 L79 R105 K9 S15 D19 K37 G38 L40 P41 P43 T44 K45 K46 E47 T50 R53 S54 P55 H56 V57 K59 R62 Q64 H70 R72 L73 R99
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP75581|RS10_MYCPN Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]