Structure of PDB 7p64 Chain I

Receptor sequence
>7p64I (length=180) Species: 469008 (Escherichia coli BL21(DE3)) [Search protein sequence]
MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVL
TRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCI
FCGLCEEACPTTAIQLTPDFEMGEYKRQDLVYEKEDLLISGPGKYPEYNF
YRMAGMAIDGKDKGEAENEAKPIDVKSLLP
3D structure
PDB7p64 A universal coupling mechanism of respiratory complex I.
ChainI
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I I48 C70 C74 I75 C99 I100 F101 C102 G103 C105 I48 C70 C74 I75 C99 I100 F101 C102 G103 C105
BS02 SF4 I C60 V61 A62 C63 N64 L65 C66 F92 C109 P110 T111 A113 I114 C60 V61 A62 C63 N64 L65 C66 F92 C109 P110 T111 A113 I114
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030964 NADH dehydrogenase complex
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p64, PDBe:7p64, PDBj:7p64
PDBsum7p64
PubMed36104567
UniProtP0AFD6|NUOI_ECOLI NADH-quinone oxidoreductase subunit I (Gene Name=nuoI)

[Back to BioLiP]