Structure of PDB 7oe1 Chain I

Receptor sequence

>7oe1I (length=127) Species: 511145 (Escherichia coli str. K-12 substr. MG1655)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 7oe1 RbfA Is Involved in Two Important Stages of 30S Subunit Assembly: Formation of the Central Pseudoknot and Docking of Helix 44 to the Decoding Center.
• Chain: I
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	I	Q4 Y6 T8 R10 K12 A15 A16 R17 F19 Q31 R32 Y37 Y63 T65 K67 G68 G69 G70 I71 S72 G73 Q74 R84 R98 T104 A107 R108 Q109 V110 E111 R112 K113 K114 V115 R118 K119 R121 R122 R123 Q125 S127 K128 R129	Q2 Y4 T6 R8 K10 A13 A14 R15 F17 Q29 R30 Y35 Y61 T63 K65 G66 G67 G68 I69 S70 G71 Q72 R82 R96 T102 A105 R106 Q107 V108 E109 R110 K111 K112 V113 R116 K117 R119 R120 R121 Q123 S125 K126 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oe1, PDBe:7oe1, PDBj:7oe1
• PDBsum: 7oe1
• PubMed: 34200244
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)