Structure of PDB 7oba Chain I

Receptor sequence

>7obaI (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]

SSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVV
FHQLGECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQ
EKEDS

3D structure

PDB

7oba Cryo-EM structures of human RNA polymerase I.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C20 C38	C10 C28
BS02	ZN	I	C87 C115	C66 C94

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006139	nucleobase-containing compound metabolic process
GO:0006351	DNA-templated transcription
GO:0006363	termination of RNA polymerase I transcription

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex

External links

PDB	RCSB:7oba, PDBe:7oba, PDBj:7oba
PDBsum	7oba
PubMed	34887565
UniProt	Q9P1U0\|RPA12_HUMAN DNA-directed RNA polymerase I subunit RPA12 (Gene Name=POLR1H)