Structure of PDB 7nyv Chain I

Receptor sequence
>7nyvI (length=158) Species: 37762 (Escherichia coli B) [Search protein sequence]
HAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPV
GCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEM
GEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKP
IDVKSLLP
3D structure
PDB7nyv Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
ChainI
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I C60 V61 A62 C63 N64 C66 C109 T111 I114 C38 V39 A40 C41 N42 C44 C87 T89 I92
BS02 SF4 I I48 C70 V72 I75 C99 I100 F101 C102 G103 C105 I26 C48 V50 I53 C77 I78 F79 C80 G81 C83
Gene Ontology
Molecular Function
GO:0003954 NADH dehydrogenase activity
GO:0005506 iron ion binding
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0050136 NADH:ubiquinone reductase (non-electrogenic) activity
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009060 aerobic respiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030964 NADH dehydrogenase complex
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nyv, PDBe:7nyv, PDBj:7nyv
PDBsum7nyv
PubMed34308841
UniProtP0AFD6|NUOI_ECOLI NADH-quinone oxidoreductase subunit I (Gene Name=nuoI)

[Back to BioLiP]