Structure of PDB 7nky Chain I

Receptor sequence

>7nkyI (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITN
IGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFF
VCLSCSHIFTSDQKNKRTQ

3D structure

PDB

7nky Structural basis of nucleosome transcription mediated by Chd1 and FACT.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	I	C7 C10	C6 C9
BS02	ZN	I	C75 C103	C74 C102

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001172	RNA-templated transcription
GO:0001193	maintenance of transcriptional fidelity during transcription elongation by RNA polymerase II
GO:0006281	DNA repair
GO:0006283	transcription-coupled nucleotide-excision repair
GO:0006351	DNA-templated transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005730	nucleolus
GO:0055029	nuclear DNA-directed RNA polymerase complex

External links

PDB	RCSB:7nky, PDBe:7nky, PDBj:7nky
PDBsum	7nky
PubMed	33846633
UniProt	P27999\|RPB9_YEAST DNA-directed RNA polymerase II subunit RPB9 (Gene Name=RPB9)