Structure of PDB 7mfm Chain I

Receptor sequence

>7mfmI (length=490) Species: 1423 (Bacillus subtilis)

KPTGFMEIKREKPAERDPLTRLKDWKEYSAPFSEEASKRQGARCMDCGTP
FCQIGADINGFTSGCPIYNLIPEWNGLVYRGRWKEALERLLKTNNFPEFT
GRVCPAPCEGSCTLAISDPAVSIKNIERTIIDKGFENGWIQPRIPKKRTG
KKVAIVGSGPAGLASADQLNQAGHSVTVFERADRAGGLLTYGIPNMKLEK
GIVERRIKLLTQEGIDFVTNTEIGVDITADELKEQFDAVILCTGAQKQRD
LLIEGRDSKGVHYAMDYLTLATKSYLDSNFKDKQFIDAKGKDVIVIGGGD
TGADCVATALRQKAKSVHQFGKHPKLPPARTNDNMWPEQPHVFTLEYAYE
EAEAKFGRDPREYSIQTTKMVADKNGKLKELHTIQMEKVKNEHGKYEFRE
LPGTEKVWPAQLVFIAIGFEGTEQPLLKQFGVNSVNNKISAAYGDYQTNI
DGVFAAGDARRGQSLIVWAINEGREVAREVDRYLMGSSVL

3D structure

• PDB: 7mfm A counter-enzyme complex regulates glutamate metabolism in Bacillus subtilis.
• Chain: I
• Resolution: 2.42 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	I	V105 V158 G159 G161 P162 A163 E182 R183 G189 L190 I195 K199 I225 T245 G246 Q248 D302 T303 D460 S466 I468	V103 V156 G157 G159 P160 A161 E180 R181 G187 L188 I193 K197 I223 T243 G244 Q246 D300 T301 D458 S464 I466
BS02	SF4	I	C46 C49 P52 C54 C114 T115 V123	C44 C47 P50 C52 C112 T113 V121
BS03	SF4	I	C67 N71 T102 C106 A108 C110 I125 K126 E129	C65 N69 T100 C104 A106 C108 I123 K124 E127

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 17:56:23 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7mfm', asym_id = 'I', title = 'A counter-enzyme complex regulates glutamate metabolism in Bacillus subtilis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7mfm', asym_id='I', title='A counter-enzyme complex regulates glutamate metabolism in Bacillus subtilis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006537,0016491,0016639,0051536', uniprot = '', pdbid = '7mfm', asym_id = 'I'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006537,0016491,0016639,0051536', uniprot='', pdbid='7mfm', asym_id='I')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>