Structure of PDB 7ly9 Chain I |
>7ly9I (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
DIQMTQSPSSLSASVGDTVTITCQANGYLNWYQQRRGKAPKLLIYDGSKL ERGVPSRFSGRRWGQEYNLTINNLQPEDIATYFCQVYEFVVPGTRLDL |
|
PDB | 7ly9 Extended antibody-framework-to-antigen distance observed exclusively with broad HIV-1-neutralizing antibodies recognizing glycan-dense surfaces. |
Chain | I |
Resolution | 3.91 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
I |
W67 G68 |
W63 G64 |
|
|
|