Structure of PDB 7kiq Chain I |
>7kiqI (length=80) Species: 10090 (Mus musculus) [Search protein sequence] |
LPDVTLSLCGGGEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYY NWALAAPMILSLQVFQKSLPKATVESWVKD |
|
PDB | 7kiq The middle lipin domain adopts a membrane-binding dimeric protein fold. |
Chain | I |
Resolution | 2.523 Å |
3D structure |
|
|
Enzyme Commision number |
3.1.3.4: phosphatidate phosphatase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
I |
I489 E494 |
I23 E28 |
|
|
|